McDonnell Genome Institute

Washington University

CircRNA

chr12|132804715|132813419|-|GOLGA3|ENST00000204726.7

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9077

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

DNTGSTDSPLPLEK

Amino Acids from 5' Exons

ALKEKAELQAQLAALSTKLQAQVECSHSSQQRQDSLSSEVDTLKQSCWDLERAMTDLQNMLEAKNASLASSNNDLQVAEEQYQRLMAKVEDMQRSMLSKDNT,HLKRRLSCRPSWPPSARSCRRRWSAATAASSGRIRARRWTPSSRAGTWSEPLTCRTCWRQKMPAWRRPTTTCRWPRSSTRGLWPRRTCRGACSARTTQ,TREGAAGPAGRPQHEAAGAGGVQPQQPAAAGFAELGGGHPEAVVLGPGASHDPAEHAGGKKCQPGVVQQRLAGGRGAVPEAYGQGRGHAEEHAQQGQH

Amino Acids from 3' Exons

ALQILPCPWRRRSRSDFRLGSGWKSSSNSTGSASRR,LYRFSPAPGEGGAGPTSGSEVAGRAAQTVQGEAPAGE,STDSPLPLEKEEQVRLQARKWLEEQLKQYRVKRQQER