McDonnell Genome Institute

Washington University

CircRNA

chr12|132784163|132813419|-|GOLGA3|ENST00000204726.7

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.995

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

10

Peptide

VLELEDEALQILPCPWR

Amino Acids from 5' Exons

ERIQALEAELQAVSHSKTLLEKELQEVIALTSQELEESREKVLELEDE,KGSRPWRRSCRLSVIARRCWKRNCRRSRPARSWRSPGRRCWSWRT,KDPGPGGGAAGCQSQDAAGKGTAGGHSADQPGAGGVPGEGAGAGGR

Amino Acids from 3' Exons

ALQILPCPWRRRSRSDFRLGSGWKSSSNSTGSASRR,LYRFSPAPGEGGAGPTSGSEVAGRAAQTVQGEAPAGE,STDSPLPLEKEEQVRLQARKWLEEQLKQYRVKRQQER