McDonnell Genome Institute

Washington University

CircRNA

chr12|132784163|132805022|-|GOLGA3|ENST00000204726.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9599

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

VLELEDEALK

Amino Acids from 5' Exons

ERIQALEAELQAVSHSKTLLEKELQEVIALTSQELEESREKVLELEDE,KGSRPWRRSCRLSVIARRCWKRNCRRSRPARSWRSPGRRCWSWRT,KDPGPGGGAAGCQSQDAAGKGTAGGHSADQPGAGGVPGEGAGAGGR

Amino Acids from 3' Exons

ALKEKAELQAQLAALSTKLQAQVECSHSSQQRQDSLSSEVDTLKQSCWDLERAMTDLQNMLEAKNASLASSNNDLQVAEEQYQRLMAKVEDMQRSMLSKDNT,HLKRRLSCRPSWPPSARSCRRRWSAATAASSGRIRARRWTPSSRAGTWSEPLTCRTCWRQKMPAWRRPTTTCRWPRSSTRGLWPRRTCRGACSARTTQ,TREGAAGPAGRPQHEAAGAGGVQPQQPAAAGFAELGGGHPEAVVLGPGASHDPAEHAGGKKCQPGVVQQRLAGGRGAVPEAYGQGRGHAEEHAQQGQH