McDonnell Genome Institute

Washington University

CircRNA

chr12|132776633|132780914|-|GOLGA3|ENST00000204726.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9969

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

8

Peptide

ATAAAAGAGSFAAQR

Amino Acids from 5' Exons

MENLKWEVDQKEREIQSLKQQLDLTEQQGRKELEGLQQLLQ,WKISNGRWIRKKEKSSPSSSWTRSSRAGRNWKGYSSCC,GKSQMGGGSERKRNPVLEAAAGLDGAAGQEGTGRATAAAA

Amino Acids from 3' Exons

VQAVLQRKEEEDRQMKHLVQALQASLEKEKEKVNSLKEQ,CRQFCSAKKRRIARSILSRPCRPHRRRRRRTASRS,AGSFAAQRRGGSPDEASCPGPAGLTREGEGEGEQPQGA