McDonnell Genome Institute

Washington University

CircRNA

chr12|132735405|132755133|-|ANKLE2|ENST00000357997.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9186

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

10

Peptide

EWEGEMTMDALLAR

Amino Acids from 5' Exons

AEDFRKLWKTPPREKAGFLHHVKKSDPERGFERVG,QKIFASSGKLHLERKQASFTTSRSRTRKEALREWE,RRFSQALENSTSRESRLPSPRQEVGPGKRLESGK

Amino Acids from 3' Exons

VKQWMLCWLDNFIQMTLEKKSSKPDNVDPLHQLQGSFLRKNWLRLYWSKEEGCLLSTTMRQVSQLSARTHKGFSQLKGTQLIRLVFLKTEILVTVWAILQRRKLHPRPARCPLVTPTPTELERLRLRSRPCTMGCVQCMRTSQREM,NDNGCSVGSIETSESRPRRNRQSRIEMWTHYINYKVHFEKIGSGFTGARRKAVFFLPPGRCHSSQPGPTKDFEASREPNSGWFFRQRFWLQCGPESSRGGSCDIQDLLGAPHRHLQSWSDCVGAAPVLWGVSSVGRPSEK,EMTMDALLARLKLLNPDDLREEIVKAGLKCGPITSTTRFIFEKKLAQALLEQGGRLSSFYHHEAGVTALSQDPQRILKPAEGNPTDQAGFSEDRDFGYSVGLNPPEEEAVTSKTCSVPPSDTDTYRAGATASKEPPLYYGVCPVYEDVPARN