McDonnell Genome Institute

Washington University

CircRNA

chr12|132642505|132642729|-|POLE|ENST00000320574.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.956

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

DEQEERR

Amino Acids from 5' Exons

EERRGPTLIAVQSSWELKRLASEIPVLEEFPLVPICVADKINYGVLDWQRHGARRMIRHYLNLDTCLSQAFEMS,RSAGGPHSSLFSPAGSRGWPVKFLSWRNSHWCLSVWLTRSTMGSWTGSAMEPGASVTTSTWTPACRRPSRA,GAPGAHTHRCSVQLGAEEAGQNSCLGGIPTGAYLCGQDQLWGPGLAAPWSPAHDPSLPQPGHLPVAGLRDEQ

Amino Acids from 3' Exons

EERRGPTLIAVQSSWELKRLASEIPVLEEFPLVPICVADKINYGVLDWQRHGARRMIRHYLNLDTCLSQAFEMS,RSAGGPHSSLFSPAGSRGWPVKFLSWRNSHWCLSVWLTRSTMGSWTGSAMEPGASVTTSTWTPACRRPSRA,GAPGAHTHRCSVQLGAEEAGQNSCLGGIPTGAYLCGQDQLWGPGLAAPWSPAHDPSLPQPGHLPVAGLRDEQ