McDonnell Genome Institute

Washington University

CircRNA

chr12|132571306|132572622|+|FBRSL1|ENST00000434748.2

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.999

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

2

Peptide

AAQARAEHAVSGAER

Amino Acids from 5' Exons

ITSCSGKSTRGFWCRAPSGLAPPWARGLCCGRSSISTSTHTSTRTNTHTSTNTHSPPSPQGCPRRRPPHPR,SRAAQARAEHAVSGAERRAAWRLPGPGGSAAGGVPSAPAHTPAHAPTHTPAPTHIRPLPRRAAPDAARRTPA,HELLRQELNTRFLVQSAERPGASLGPGALLRAEFHQHQHTHQHTHQHTHQHQHTFAPFPAGLPPTPPAAPPP

Amino Acids from 3' Exons

FFPSFPPAIPGLPTLLPHPGPFGSLQGAFQPK,SSRPSLLPSRDCPPCSHTPAPSGPCRALFSL,LPVLPSCHPGTAHPAPTPRPLRVPAGRFSA