McDonnell Genome Institute

Washington University

CircRNA

chr12|131986513|132023941|+|EP400|ENST00000389561.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9767

48

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

20

Peptide

FTLSHSQLRQLTAGQPLQLQDGSIDK

Amino Acids from 5' Exons

MVASTRLPVDPAPPCPRPLPTSSTSSLAPVSGSGPGPSPARSSPVNRPSSATNKALSPVTSRTPGVVASAPTKPQSPAQNATSSQDSSQDTLTEQITL,WHRQGSLWTLPRPAHGLCPPLLPRPSRLVAPAQDPPLLDPLQIDLPQPPIRHYLQSLPGPQGWWHLPPPNHRVLLRMPPRPKTVLRIRQNKL,GSIDKAPCGPCPALPTASAHLFYLVPRACEWLRPRTLPCSILSSKTFLSHQGTISSHFPDPRGGGICPHQTTESCSECHLVPRQFSGYADRTNNS

Amino Acids from 3' Exons

VERKLSWHPSQDHRAAWLSQRRRHCSSRAASSPCHTASSGSSQRASRCSCK,WRGSENSSAGIHHRTTEPRGSARDAGDTAVPGQQVHPVTQPAPAAHSGPAAAAA,GEVVKIAQLASITGPQSRVAQPETPVTLQFQGSKFTLSHSQLRQLTAGQPLQLQ