McDonnell Genome Institute

Washington University

CircRNA

chr12|131929906|131932312|+|PUS1|ENST00000322060.9

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9935

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

AAHGLFGQGLPR

Amino Acids from 5' Exons

LAAHGRERGAAARRSRMPPGPEVLQRPGRGRPRLGGRRTSGEEAQERWRRGAAREAAQAEDRAAHGLFGQGLPRHA,SPRMAGNAEPPPAGAACPQDRRSCSGRAGGDRVWEDGEHPAKKLKSGGDEERREKPPKRKIVLLMAYSGKGYHGMQ,RRAWPGTRSRRPPEPHAPRTGGPAAAGPGATASGRTENIRRRSSRAVATRSGARSRPSGRSCCSWPIRARATTAC

Amino Acids from 3' Exons

RNVGSSQFKTIEDDLVSALVRSGCIPENHGEDMRKMSFQRCARTDK,GMSGPHNSKQLKMTWCPPSSGQAVFLKIMVRTGKCPSSAAPGQT,ECRVLTIQNNRLGVRPRPVRLYSKSWGHEENVLPALRPDRQ