McDonnell Genome Institute

Washington University

CircRNA

chr12|130361179|130363144|+|PIWIL1|ENST00000245255.7

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

13

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

3

Peptide

LSVCCQVIGR

Amino Acids from 5' Exons

VVCLLSSNRKDKYDAIKKYLCTDCPTPSQCVVARTLGKQQTVMAIATKIALQMNCKMGGELWRVDIP,LSVCCQVIGRTNTMLLKNTCVQIALPQVSVWWPEPANSKLSWPLLQRLPYRTARWEESSGGWTS,CLSVVKSEGQIRCYKIPVYRLPYPKSVCGGPNLRQTANCHGHCYKDCPTDELQDGRRALEGGHP

Amino Acids from 3' Exons

RLGLGIAAMSTCPAGSSCTAMAETASKHWTTKCHSFWIVNPLVEVT,GSEGLELQVHAQPDHRVPRWRRRRPAENTGELRSATVFGLSKIHWRLQ,ALRAWNSCNEYMPSRIIVYRDGVGDGQLKTLVNYEVPQFLDCLKSIGRGY