McDonnell Genome Institute

Washington University

CircRNA

chr12|1289851|1410453|+|ERC1|ENST00000347735.10

Cancer

Type of Peptide

PRAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9929

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

TVEELLMAMEK

Amino Acids from 5' Exons

VEELLMAMEKVKQELESMKAKLSSTQQSLAEKETHLTNLRAERRKHLEEVLEM,WRSYWPWRRSRNNPKQSCPPPSSLWQKRKLTLIFGQREGNTRKFWR,GGVTDGHGEGKAGTRIHESKAVLHPAVSGRKGNSLDSSGREKETLRGSSGDE

Amino Acids from 3' Exons

DEEEGIWAPIRGLVQPFCSE,MRRRVYGHSQSEAFSHFVQN,GGGYMGIANQRLSSAILFRT