McDonnell Genome Institute

Washington University

CircRNA

chr12|124385744|124402561|-|NCOR2|ENST00000356219.7

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9298

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

20

Peptide

MQQQQQQQQQQQQQQQQPMPR

Amino Acids from 5' Exons

VSWNTAATGRPSPGWWAPRLCRSVRTSTSTTRRGRTSMRSCSSTSR,SPGTRPQLVGHRPDGGLQDCVAVELLLQLQEEAEPRDLAAAQAED,LLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKRQNLDEILQQHKLKM

Amino Acids from 3' Exons

QQQQQQQQQQQQQQQQPMPRSSQEEKDEKEKEKEAEKEEEKPEVENDKEDLL,SSNNSSSSSSSSSSSSPCPAAARRRKMRRRRKRRRRRRRRSRRWRTTRKTSS,AATTAAAAAAAAAAAAHAPQQPGGEREGEGKGGGEGGGEAGGGERQGRPPQ