McDonnell Genome Institute

Washington University

CircRNA

chr12|124327546|124346850|-|NCOR2|ENST00000404621.5

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9708

8

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

3

Peptide

ALMGIPR

Amino Acids from 5' Exons

ALPIEARRCRNMPAPTWGWRPLERHSW,PYDLKPGGAGTCQHQHGAGGHNKGTH,LMTYRSQAVQEHASTNMGLEAIIRKALM

Amino Acids from 3' Exons

GSLGPTWRHRRTTCVGRPSSSGRARLRPHRPHGTPRPTRRRPWAPSSRPMRAWWPRRRRAAPSMRSRARSCGTRPSCPWPRGRSRRAPSR,DPSVLRGGTGGLPASGGQAPKAGGHASAPTALTGPDRGLQDAGPGPPEAEAGPGPGGHGEGGGPLHPDPARGAAAHARAAPGPAAAQGGLHHA,IPRSYVEAQEDYLRREAKLLKREGTPPPPPPSRDLTEAYKTQALGPLKLKPAHEGLVATVKEAGRSIHEIPREELRHTPELPLAPRPLKEGSITQ