McDonnell Genome Institute

Washington University

CircRNA

chr12|123605930|123606159|+|DDX55|ENST00000545042.1

Cancer

Type of Peptide

BRCA-Luminal B

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9865

32

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

11

Peptide

TLCLQVTGSGK

Amino Acids from 5' Exons

SATIPLFMRNKDVAAEAVSASGMCSLSSCSPSDELGRKGNQNSLFAGHRWQNTRFCHPHPGNSSEKRREVKKES,PQPSLCSCETKMSLQKRVPRVCAACPRVLPQMNSEEERETKTLCLQVTGSGKTLAFVIPILEILLRREEKLKKSQ,RNHPSVHAKQRCRCRSGECLGYVQPVLVFSLRTLRKKGKPKLSVCRSQVVAKHSLLSSPSWKFFEEKRSKRV

Amino Acids from 3' Exons

SATIPLFMRNKDVAAEAVSASGMCSLSSCSPSDELGRKGNQNSLFAGHRWQNTRFCHPHPGNSSEKRREVKKES,PQPSLCSCETKMSLQKRVPRVCAACPRVLPQMNSEEERETKTLCLQVTGSGKTLAFVIPILEILLRREEKLKKSQ,RNHPSVHAKQRCRCRSGECLGYVQPVLVFSLRTLRKKGKPKLSVCRSQVVAKHSLLSSPSWKFFEEKRSKRV