McDonnell Genome Institute

Washington University

CircRNA

chr12|123218375|123227616|-|MPHOSPH9|ENST00000541076.6

Cancer

Type of Peptide

OSCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

MEVQDLNK

Amino Acids from 5' Exons

CYNIMGTKTEAEPTKESTCRRWRFKITRKAKEDTNE,NAITSWAQKLKQNQPKRAHVEDGGSRSKQGNEQSKKTPIEK,MLHHGHKNSRTNQREHMKMEVQDLNKEMSKVRRHQLR

Amino Acids from 3' Exons

KSPPYKWGILFLREDQTICNSRYSSPNFFNARATKQWKDFGTLEKL,SSPHLSTNGVSSFSGKTRPSVIQGTVEVLTSLMQELQNSGKTDSELWKNCE,VVPTLVQMGYPLSQGRPDHLFKVQLKSLLCKSYKTVERLIRNFGKTV