McDonnell Genome Institute

Washington University

CircRNA

chr12|123009849|123014042|-|PITPNM2|ENST00000280562.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9738

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

GSSTTPK

Amino Acids from 5' Exons

TSSTLSKTLCPTTSIRQKRTPSCSSQPRPSGGPCPRTGSRSTRSRSSPSCAHTSSARWSSATGACSPRSRGSSTTP,LHRHCQRPCAPQRVDRRGPQAVPVNQDPAGAPVRELDRGVQEAGLPHHVRIQALQGGVPLLGHAVQDREVHPRH,FIDIVKDPVPHNEYKTEEDPKLFQSTKTQRGPLSENWIEEYKKQVFPIMCAYKLCKVEFRYWGMQSKIERFIHDT

Amino Acids from 3' Exons

KKSRNETYGEGSGVEILENRPYTDGPGGSGQYTHKVYHVGMHIPSWFRSILPKAALRVVEESWNAYPYTRT,RRAVTRHMAKAAAWRSWRTGRTQMAQAALGSTHTRCIMWACTFPAGSAPSCPRQPCGWWRSLGMPTPTPEP,EEPRDIWRRQRRGDPGEPAVHRWPRRLWAVHTQGVSCGHAHSQLVPLHPAQGSPAGGGGVLECLPLHPNQ