McDonnell Genome Institute

Washington University

CircRNA

chr12|122994800|123005548|-|PITPNM2|ENST00000280562.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9287

19

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

2

Peptide

TVIPALDGLR

Amino Acids from 5' Exons

PPCQRAEDALLTPFQQLHHAGWHRCPGQVLDHRPLPLRVPAGAGPGLEEDCHPSPG,LHASVLRTEPCSRHSSSSTMLDGTGALGRFDFEITDLFLFGCPLGLVLALRKTVIPALD,SMPACGLSPAHAIPAAPPCWMAQVPWAGLTLRSPTSSSSGARWGWSWPGRLSSQPWM

Amino Acids from 3' Exons

DYGGWCGLTGRPGAGRTSGMGAWRTSGSWRRRHSSCFPVRWPSSMRMVRRPLSSSSTKPSRTRPLGSPRSPAAAMGSPWGAASRNSGPHPPSRLGRPSGE,TTEGDGAGSPAGLVLAGRVVWAEHGEHPGAGEGGTAHAFPDGPVQGWGGHARQARSRLGPDLWGAPGAQQQQWGAPSGARPQETVVHILQVVSVVQAG,LRRVMVRAHRQAWCWQDEWYGLSMENIRELEKEAQLMLSRKMAQFNEDGEEATELVKHEAVSDQTSGEPPEPSSSNGEPLVGRGLKKQWSTSSKSSRSSKRG