McDonnell Genome Institute

Washington University

CircRNA

chr12|122477840|122482087|-|ZCCHC8|ENST00000536306.5

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9084

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

10

2

Peptide

DLPPTWSSIQPR

Amino Acids from 5' Exons

PGVKSGNKRSSSHSSPGSPKKQKNESNSAGSPADMELDS,QVSLATRGLHLTLAQVVQRSRRMKATQRDLPPTWSSIQ,RCEVWQQEVFISLPRSKEAEEKQLSGISRRHGARF

Amino Acids from 3' Exons

PRNAARISEKRKEYMDACGEANNQNFQQRYHAEEVEERFGRFKPGVI,LGMLLEVKREKSIWMPVEKQTIRISSSDTTQKKKKDLEDSSQELL,SECCSNKKEKRVYGCLWRSKQSEFPAAIPRRRSRRKIWKIQARSY