McDonnell Genome Institute

Washington University

CircRNA

chr12|122316748|122354556|-|CLIP1|ENST00000302528.11

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9684

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

8

Peptide

KEIMSWNWKPK

Amino Acids from 5' Exons

LDTLKENNLKNVEELNKSKELLTVENQKMEEFRKE,WTHLKKTTKMWKSTNQKNSLRIKKWKNLGKK,GHTRKQLEKCGRAEQIKRTPDCRESKNGRIERN

Amino Acids from 3' Exons

HVLELEAKMDQLRTMVEAADREKVELLNQLEEEK,MSWNWKPKWTSCEQWWKLLTGRRWSFSTSLKRRK,CPGIGSQNGPAANNGGSCQGEGGASQPARGEK