McDonnell Genome Institute

Washington University

CircRNA

chr12|122232325|122244762|-|RP11-512M8.5|ENST00000535844.1

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9616

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

3

Peptide

FLSQLEDGGYVK

Amino Acids from 5' Exons

VNREKTELYFSLGAPSLKLLPCDFSPSWKME,STGRKPSDSDIFPWGRNLRNCCPAISLPVGRW,QPGENRVTLIFFLGGVTFAEIAALRFLSQLEDG

Amino Acids from 3' Exons

VMNYLQRNLHLRNRAMVVRTSPRKQRSCSILQRSSMLRSEIRTSTQLALCSARKQRSSLQHS,LCEITSREICTETGRWWGPPHGSKEAAAEFCRGALCDPRELQRSWLCAQQESKDHLCSIR,YVKLPPEKFAPKKQGDGGKDLPTEAKKLQLNSAEELYAEIRDKNFNAVGSVLSKKAKIISAAFE