McDonnell Genome Institute

Washington University

CircRNA

chr12|122035330|122054989|+|BCL7A|ENST00000538010.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

17

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

20

Peptide

QPSGDSGLAAETSAISQVPR

Amino Acids from 5' Exons

KNKNKKKGKDEKCGSEVTTPENSSSPGMMDMH,KTRIRKKARTRSVAQRPLRRTVPPQGWTCM,KQEEKRQGREVWLRGDHSGEQFLPRDDGHA

Amino Acids from 3' Exons

MLLMSRIHSPRWNIRTAQRKIGSRLETRVWPQRRLQSLRYLARGLRGAARSAGSPLGCR,CFAEFTVLDGTFDEQLRESRSAAVWRLGSGRRDVCNLSGTSLEVSEGQPDRPGAHWVVG,ASDEQNSQSSMEHSMNSSEKVDRQPSGDSGLAAETSAISQVPRSRSQRGSQIGREPIGLSG