McDonnell Genome Institute

Washington University

CircRNA

chr12|12147365|12165295|-|LRP6|ENST00000261349.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9695

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

10

Peptide

AVISQVMNTDGTGRR

Amino Acids from 5' Exons

VYVFYQSSGKVSNTGCFGWDRTGGPLFQWLKTNCFSPQAGQALLGFRSPANKQSL,YMYFTNLQERSPKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLS,ICILPIFRKGLLKLNGLLWMGQNGRSSFSVAVNQLLPLIAGWASSFGLIQISGELKAVISQ

Amino Acids from 3' Exons

VMNTDGTGRRVLVEDKIPHIFGFTLLGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVI,LILMALGDEYWKTKFLTYLDLLCWVTMFTGLTGRGVALKEFINEVQRGKSISCLTSWARLQMFIEL,YEYWHWETSTSGRQNSSHIWIYFVGLCLLDLAEAHKSSTKCREGSDHRSAAPHGPKGYKCSSSD