McDonnell Genome Institute

Washington University

CircRNA

chr12|121439856|121441233|-|KDM2B|ENST00000538503.5

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9776

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LAGGPFR

Amino Acids from 5' Exons

GSGTWCCQAAHGSRSRPFAAPVVRCSGPWMSSGWRDRMPRCGISCPRPQTTGQVSCQAGGFCGGGVSELDCWICFYPQTPAVPQRTGVSAAMFSVCFRHRGDLGGGRGSCAHVRLAPGAPRASLCFPVDSLMGLCVCLTAFLLTRSWGSACISLLFCLAPRWFQASTAIGISVVVQRLPGWHLPLDWAGLPRSVLLAKPWGSEMLRSLCTGWLMTTGWNVGIVFLGLLVFQENLKIVLMWSLIFHCWNYDFGRKQFITKNLSVLSGWWAFSVMSAPGLLGQIDGLPPPSCPTRSDGQSEQAPEHRGAAPGRPGHHRCLPAAHHPPHAPALQAPPQLLPRHRPVYQPAHCCWHHHPRLLNRDQPV,APGLGAVRLLMDRGLGPLQLQLSAAPDPGCPVGGGTKGCPDAGSPVPAHRQQARVARLGVSVGVGASTVGSAFTLRPQLFPKGHRDESLLPCSQFASGTEGIWEEAGAPVHTDSLLGLRVRLSAFLLTRSWGSACVSLLSYLAHGALRASHFFSVDLPLVGFKPPLPSGSVWLCKGFQDGTSPWTGLDCLGPCFSPSHGDRRCCAASALVGLLGGMWACFVFFFKRIKSKFCGVFFTVGIMILGGSSLLNEIVFCLAGGPFRVSCQHDQASSVRLTGCPLLPAPPGQMDNRSKLRNIVELRLAGLDITDASLRLIIRHMPLLSKLHLSYCNHVTDQSINLLTAVGTTTRDSLTEINLS,LRDLVLSGCSWIAVSALCSSSCPLLRTLDVQWVEGLKDAQMRDLLSPPTDNRPGELPGWGFLWGWGERARLLDLLLPSDPSCSPKDIGMSLCCHVLSLLQAQRGSGRRQGLLCTRETRSWGSACVSLLSCLAHGALRVSHCFLIDSLMGLCVHLTSFLLTCPSLVSSLHCHRDQCGCAKASRMAPPPGLGWTAVRASRQAMGIGDAAQPLHWLADDYWVECGHSVSRSFSFSRESENLSFDVESDFSLLELFWEEAVYNMKSECSVWLVGLLECHVSMTRPPRSDRVAPSFLPHQVRWTIGASSGTSWSCAWQAWTSQMPPCGSSSATCPCSPSSTSVTVTTSPTSLSTCSLLLAPPPETPPRSTCL

Amino Acids from 3' Exons

VLRAVVDPHPEPLQVYHTPDAEWHHPATARLPRPQLDQYLQEAAELAHQPAA,CCDKRLWTRIDLNHCKSITPLMLSGIIRRQPVSLDLSWTNISKKQLSWLINRLP,AAISGCGPALTTTASLSHPCVASSGDSPSPSTSAGPISPRSSAGSSTGCL