McDonnell Genome Institute

Washington University

CircRNA

chr12|121328315|121346031|-|ANAPC5|ENST00000261819.7

Cancer

Type of Peptide

OSCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9266

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

3

4

Peptide

AAGLFLR

Amino Acids from 5' Exons

YLASLGIQSLVQQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGR,TSPPWEYSPLFNRELLLGRRQTSWMPRTPTSCTGNTACQSSSISASHRKRPSGGCMAA,PRLPGNTVPCSTESFCWEDGKQADGCPKGLRPPALETQPVRAHRYQHRTENGHLEAVWPQ

Amino Acids from 3' Exons

VCFCVTSWPTVSFLSAKCLNCTLPFSSTSRMVRKRQWRMLIWNPVEMRVKEKWKKKNLMYL,FVSASHDLGLQAFFQPSVTVHCPSAVLPEWEKDSGGCYGTDQRGKKNGKRRTCICK,LFLRHMILAYSKLSFSQVFKLYTALQQYFQNGEKKTVEDADMELTSRDEGERKMEKEELDVSV