top of page

McDonnell Genome Institute

Washington University

CircRNA

chr12|121221912|121223043|+|P2RX4|ENST00000499638.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9209

7

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

28

Peptide

DGFYHVGQAGLELLTSGDPPASASQSAR

Amino Acids from 5' Exons

EENSLFVMTNVILTMNQTQGLCPE,RKTPSSSPTSSPTRHRACAP,GKLPLRHDQRDPHHEPDTGPVPR

Amino Acids from 3' Exons

IPDATTVCKSDASCTAGSAGTHSNGTSLWPPGEGGPADRPHCGASLIEKSSQFLHMTLGEPGAEAGVLEPLYIHCCHWSPTSHPSSCPTVFFFVVVVVFSCFFFCFVFLFFARVSLCHPNWSAMASRLTATSTSQFQTILLPQPPELGLQACTTTPSFLYFWRWVLPCWPGWSRTPDLRSTRLSLPKCDYRHDPLCLASCPILLGITLAEMWLAHRLSSSDSNSWTVTLSKSQICTAQDWLHGRLDGALTPYSKKVENRRPLWTWDPPATLVLVGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVP,FQMRPLCVNQMPAVLPALPAPTATVRACGLLGRAAPEQIAPTVERLRNLPNSFTPWVSQVPRLGSWSPSTFTAVIGAPQAIPALALLFFFLLLLLFFLVFFFVLFFCFFEPESRSVTQTGVQWHDLGSLQPPPPSFKQFSCLSLPSSWDYRHAPPRPANFCTFGRDGFYHVGQAGLELLTSGDPPASASQSARITGMTHCAWPLVPFFSLASPWLRCGWHTGNCLPPILTPGQHCLNPRFAQLKTGCMGGWMGLSLPTPKRKIGDPCGHGTPLPPLCLESQQAGALSTGLSRRVRWRPGARWRMTHTCH,SRCDHCVIRCQLYCRLCRHPQQRYELVASWGGRPLSRSPPLWSVSDREIFPIPSHDPGARCRGWGPGAPLHSLLSLEPHKPSQLLPYCFFFCCCCCFFLFFFLFCFFVFLSQSLALSPKLECNGMISAHCNLHLPVSNNSPASASRVAGITGMHHHAQLIFVLLVEMGFTMLARLVSNSPQVIHPPQPPKVLGLQAPTVPGLLSHSLAWHHPGDVAGTQVTVFLRFLLDSDTVIPDLHSSRLAAWEAGWGSHSLLQKGRKETPVDMGPPCHPCACRSLNRQVRSFQRVCQDVGGGLVPGGGHTRAT

bottom of page