McDonnell Genome Institute

Washington University

CircRNA

chr12|12121085|12203400|-|LRP6|ENST00000538239.5

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9791

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

12

Peptide

MFMYWTDWGEVPK

Amino Acids from 5' Exons

LQAILPALCTPHHTLQHRCLQLCSSENDLSGNSQGLYQLELFRTCAPTSHTPKPILVSRGELKLPTFSIHREELFSSPLPTATLSLYRLLLRRGPPPLTASNVK,YRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDLNYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSSGGALLLLPPTK,TGHIATGTLHPPPHPAAQMFVTVTMLLVGEPQWQQPRAIPVTTMIQNLCPHLPHPEANTCQQRRTMKAAHLLHTQRGAILITSTHRHPLPVQTPPEEGPSSSDCLQRKN

Amino Acids from 3' Exons

VHVLDRLGRSAKDRTCWNGWFKSLHYNKQNLLAKWTDFGLRTKALLGRCKTFHPQIKSGWNKS,FMYWTDWGEVPKIERAGMDGSSRFIIINSEIYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTN,SCTGQTGEKCQRNVLEWMVQVASLTVKFTGQMDLWIMKNKSFIGQMQNLISSTNQIWMEQI