McDonnell Genome Institute

Washington University

CircRNA

chr12|120738532|120738670|+|ACADS|ENST00000242592.8

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9999

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

32

Peptide

LQVIQQTLDMGRIGIASQALGIAQTALDCAVNYAENR

Amino Acids from 5' Exons

QTLDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQ,KPWTWAASASPPRPWALPRPPSIVLTTLRIAWPSGRPSPSSRSS,NPGHGPHRHRLPGPGHCPDRPRLCCELRESHGLRGAPHQAPGHP

Amino Acids from 3' Exons

QTLDMGRIGIASQALGIAQTALDCAVNYAENRMAFGAPLTKLQVIQ,KPWTWAASASPPRPWALPRPPSIVLTTLRIAWPSGRPSPSSRSS,NPGHGPHRHRLPGPGHCPDRPRLCCELRESHGLRGAPHQAPGHP