McDonnell Genome Institute

Washington University

CircRNA

chr12|120159824|120160255|-|GCN1L1|ENST00000300648.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9669

11

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

17

Peptide

GGAADQQAEGDAAGPAR

Amino Acids from 5' Exons

LDGELEAALGLLDIILAKNPSGLTQYIPVLVDSFLPLLKSPLAAPRIKNPFLSLAACVMPSRLKAL,WMGSWRRRLDCWTSSWPRTRPAPSTSLFWSTLFCPCSLPWLLPGSRTPSCPWLPVSCPLGSRLW,GWGAGGGAWTAGHHPGQEPVRPDPVHPCFGRLFSALAEVSPGCSQDQEPLLVLGCLCHALAQGF

Amino Acids from 3' Exons

EIKKKKGIKEEVQLTSKQKEMLQAQLDREAQVRRRLQE,RRRRKASKRRCSPASRRRCCRPSTGRRRSGGGCR,DKEEERHQRGGAADQQAEGDAAGPARQGGAGPEAAAG