McDonnell Genome Institute

Washington University

CircRNA

chr12|120156911|120158030|-|GCN1L1|ENST00000300648.6

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9171

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

8

17

Peptide

DGLASLTGAAPLSAPAFSLVFPFLK

Amino Acids from 5' Exons

NGPELLPRVAMLRLLTWVIGTGSPRLQ,MARSCCLAWPCCVFLGSGRARLAY,WPGVAASRGHAASSDLGDRDGLASLT

Amino Acids from 3' Exons

VLRPCPRQPSPSSRFRWCRRCPTTVRRRRSGWPRFFRSSLSKPSGPPPTPHPGGWT,CCALVRASLLLSLPVSEDGADGDAPPQGGGGVDGPDSSDPHCPSPAEGLPQHPTRAGGR,AAPLSAPAFSLVFPFLKMVLTEMPHHSEEEEEWMAQILQILTVQAQLRASPNTPPGRVDE