McDonnell Genome Institute

Washington University

CircRNA

chr12|120151144|120151391|-|GCN1L1|ENST00000300648.6

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9874

92

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

RTSAGER

Amino Acids from 5' Exons

VQESVASCLPPLVPAIKEDAGGMIQRLMQQLLESDKYAERKGAAYGLAGLVKGLGILSLKQQEMMAALTDAIQDKKNFRRRE,SRSPPAACHPLCQPSRRMLEGSRGLCSSCWSQTSTQSAKGPPMAWRAWRAWASSRSNRRWRHLMPSKIRRTSAGER,PGVRSQLLATPCASHQGGCWRDDPEAYAAAAGVRQVRRAQRGRLWPGGPGEGPGHPLAEATGDDGGTDCHPREELPPAR

Amino Acids from 3' Exons

VQESVASCLPPLVPAIKEDAGGMIQRLMQQLLESDKYAERKGAAYGLAGLVKGLGILSLKQQEMMAALTDAIQDKKNFRRRE,SRSPPAACHPLCQPSRRMLEGSRGLCSSCWSQTSTQSAKGPPMAWRAWRAWASSRSNRRWRHLMPSKIRRTSAGER,PGVRSQLLATPCASHQGGCWRDDPEAYAAAAGVRQVRRAQRGRLWPGGPGEGPGHPLAEATGDDGGTDCHPREELPPAR