McDonnell Genome Institute

Washington University

CircRNA

chr12|120148166|120168300|-|GCN1L1|ENST00000300648.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9503

9

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

2

Peptide

NPEILEAK

Amino Acids from 5' Exons

GQWSFLGQWRTVLLSSCHPVYPTLCPSLRRCPTPMSKSRRLDSRRSGRSAPLSGTRRSW,VSGASWGNGVLCSAAVILSTQHCAQAYGGADRLPCQSPEGWTAGAQADRLRYQEPGDP,SVELLGAMAYCAPKQLSSCLPNIVPKLTEVLTDSHVKVQKAGQQALRQIGSVIRNPEIL

Amino Acids from 3' Exons

RPNAVSGSLWMRKSRFSLLRNSWSWLQRM,GQTEQFLAVDCGEKAGFHFEIPGHGFRG,AKLSSFWQLIVDEKKQVFTSEKFLVMASED