McDonnell Genome Institute

Washington University

CircRNA

chr12|120148166|120150043|-|GCN1L1|ENST00000300648.6

Cancer

Type of Peptide

OV

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9997

28

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

14

Peptide

NPEILGALFAFEMLCTMLGK

Amino Acids from 5' Exons

GQWSFLGQWRTVLLSSCHPVYPTLCPSLRRCPTPMSKSRRLDSRRSGRSAPLSGTRRSW,VSGASWGNGVLCSAAVILSTQHCAQAYGGADRLPCQSPEGWTAGAQADRLRYQEPGDP,SVELLGAMAYCAPKQLSSCLPNIVPKLTEVLTDSHVKVQKAGQQALRQIGSVIRNPEIL

Amino Acids from 3' Exons

EPSLPSRCSAPCWGNFLSRMWFTCCPICSCALGMETSMCV,SPLCLRDALHHAGETFAVCGSRAAPSAPVLWGWKPVCA,ALFAFEMLCTMLGKLFEPYVVHVLPHLLLCFGDGNQYVRE