McDonnell Genome Institute

Washington University

CircRNA

chr12|119760938|119770910|-|CIT|ENST00000392521.6

Cancer

Type of Peptide

OV

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9998

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

10

Peptide

SQQIQQMADK

Amino Acids from 5' Exons

VLDNQIKKDLADKETLENMMQRHEEEAHEKGKILSEQKA,CWTIRRKTWLTRRHWRTCRDTRRRPMRRAKFSANRR,VGQSDKERPGQGDTGEHDAETRGGGPEGQNSQRTEG

Amino Acids from 3' Exons

ERRHSLENKVKRLETMERRENRLKDDIQTKSQQIQQMADKIL,NAAILWRTRRDRPWSVEKTDRMTSRQNPNRSSRWLIKF,TPPFSGEQGKETRDHGARKQTEGHPDKIPTDPADGNS