McDonnell Genome Institute

Washington University

CircRNA

chr12|118172456|118181607|-|TAOK3|ENST00000392533.7

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9983

1

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

11

3

Peptide

RHEVEQQNIREVTR

Amino Acids from 5' Exons

EMNEDHSTPKKEKQERISKHKENLQHTQAEEEAHLLTQQRLYYDKNCRFFKRKIMIKRHEVEQQNIRE,KMRTIAHPRKRSKSGSPNIKRTCSTHRLKRKPTFSLNRDCTTTKIVVSSSGKSSGTRWSSRTFG,NEGPHTQEREARADLQTRELAAHTGRGSPPSHSTETVLRQKLSFLQAENNDQAARGGAAEHSG

Amino Acids from 3' Exons

VTRQIHEHEQENELREQMSGYKRMRRQHQKQLIALENKLKAEMDEHRLKLQKEVETHANNSSIELEKLAKKQVAIIEKE,LHDRSMSMSRRTSCGNRCQVISGCGASTRSSSPWRTSRLRWTSTASSYRRRWRRMPTTRPSSWRSWPRSKWLSKR,YTTDPAAGERVAGTDVRLADAAPAPEAADRPGEQAEGDGRAPPQATEGGGDACQQLVHRAGEAGQEASGYHRKG