McDonnell Genome Institute

Washington University

CircRNA

chr12|1180539|1371977|+|ERC1|ENST00000347735.10

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9035

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

2

Peptide

QQIENLQEQLR

Amino Acids from 5' Exons

IENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEK,LKIFKSSLETRKSRAAKNGSNPCRLTPPTLTLPQLWRRPLQR,KSSRAARQGKADEQLERTGQILAGHHQHHCLDNFGGGPCRE

Amino Acids from 3' Exons

ARSSSGCHKRRQYSSLGAFVLEEDPRGSGCPEAGEGSSGTAAAA,QEALLAAISEKDANIALLELSSSKKKTQEEVAALKREKDRLVQQLKQQ,KKLFWLPLVKKTPILSWSFRPLRRRPKRKWLPSGRRIVWYSSLSS