McDonnell Genome Institute

Washington University

CircRNA

chr12|1180539|1236904|+|ERC1|ENST00000347735.10

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9193

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

9

13

Peptide

REDNLNDSSQQLQIENLQEQLR

Amino Acids from 5' Exons

IENLQEQLRDKEKQMSSLKERVKSLQADTTNTDTALTTLEEALAEK,LKIFKSSLETRKSRAAKNGSNPCRLTPPTLTLPQLWRRPLQR,KSSRAARQGKADEQLERTGQILAGHHQHHCLDNFGGGPCRE

Amino Acids from 3' Exons

ASERPEEGSKSEAQGTGGKKEECTNVRGGATTGGQSQRQLSAAT,QVKDQNKKVANLKHKEQVEKKKSAQMLEEARRREDNLNDSSQQLQ,KKTRIRRQISTRNRWKKRRVHKCRRRDDGRTISTTALSSY