McDonnell Genome Institute

Washington University

CircRNA

chr12|116237467|116237705|-|MED13L|ENST00000281928.7

Cancer

Type of Peptide

BRCA-Basal-like

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.916

4

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

4

7

Peptide

MNCRAELTGIK

Amino Acids from 5' Exons

AELTGIKWRRYNFGGHGDCGPIISAPAQDDPILLSFIRCLQANLLCVWRRDVKPDCKELWIFWWGDEPNLVGVIHHELQ,LNSRESNGVGTILEGMGTVDPFQPQPKMIQFCVSSAVCKLTCFVYGVVMSNQIAKSYGYSGGEMNPTWVYIMNCR,THGNQMAVQFWRAWGLWTHNFSPSPRSNSVKFHPLSASPALCMASCQTRLQRVMDILVGRTQPSGCNTSTA

Amino Acids from 3' Exons

AELTGIKWRRYNFGGHGDCGPIISAPAQDDPILLSFIRCLQANLLCVWRRDVKPDCKELWIFWWGDEPNLVGVIHHELQ,LNSRESNGVGTILEGMGTVDPFQPQPKMIQFCVSSAVCKLTCFVYGVVMSNQIAKSYGYSGGEMNPTWVYIMNCR,THGNQMAVQFWRAWGLWTHNFSPSPRSNSVKFHPLSASPALCMASCQTRLQRVMDILVGRTQPSGCNTSTA