McDonnell Genome Institute

Washington University

CircRNA

chr12|113947333|113949036|-|RBM19|ENST00000261741.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9315

12

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

7

Peptide

RTSPPPR

Amino Acids from 5' Exons

VPCLSSTTPSTAPRNPRVLHSSPSCSLSTLRPTRRWTGRYS,SPVAPLPHRQPDQETQGFCIHHLHVPARCEGLLGGGRAGIP,PLSELHYPIDSLTKKPKGFAFITFMFPEHAVKAYSEVDGQVFQ

Amino Acids from 3' Exons

VGATSRCSGKRTSPPPRVHQRIPPNPGKAGYSGRTKRRRTWPNPEGSLYGTCPTPAPRRIWRSSSPNM,WALHRGVQGKERPHHQGCTKEYHQILARPDTRGERRGGGPGRIRKALCTEPALHQHRGGSGEALLQI,GRYIEVFREKNVPTTKGAPKNTTKSWQGRILGENEEEEDLAESGRLFVRNLPYTSTEEDLEKLFSKY