McDonnell Genome Institute

Washington University

CircRNA

chr12|113226727|113226964|+|TPCN1|ENST00000335509.10

Cancer

Type of Peptide

BRCA-Luminal B

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

16

Peptide

ELKPETISSPGYHILR

Amino Acids from 5' Exons

KMPLMEEFLSSTPGPVALKGSSNQRLFQALDIISGPQEKRTWLVWMTTCRSSPWMRVAVPHWLPPTAWAKKSYLAK,RCLWRSFAAPLAQWLKGAQTRDYFKPWISYPEGHRRREHGCEFGRRAAHPDLGGWQCPTGSLQRPGPRRATQ,DASNGGVSEQHPWPSGFERELKPETISSPGYHILRATGEENMAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSK

Amino Acids from 3' Exons

KMPLMEEFLSSTPGPVALKGSSNQRLFQALDIISGPQEKRTWLVWMTTCRSSPWMRVAVPHWLPPTAWAKKSYLAK,RCLWRSFAAPLAQWLKGAQTRDYFKPWISYPEGHRRREHGCEFGRRAAHPDLGGWQCPTGSLQRPGPRRATQ,DASNGGVSEQHPWPSGFERELKPETISSPGYHILRATGEENMAVSLDDDVPLILTLDEGGSAPLAPSNGLGQEELPSK