McDonnell Genome Institute

Washington University

CircRNA

chr12|113172352|113180005|-|DDX54|ENST00000306014.9

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9084

16

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

7

7

Peptide

LFLHRVGLSYPVFK

Amino Acids from 5' Exons

LLTTQRVSCAHIYSALDPTARKINLAKFTLGKCSTLIVTDLAARGLDIPLLDNVINYSFPAKGKLFLHRV,CRPSGAAPTSTVPTRQPARSISPNSRLASAPLSLLTWPPEAWTSRCWTMSSTTASPPRANSSCTAW,ADDPAGELRPHLQCPRPDSPQDQSRQIHAWQVLHSHCDPGRPRPGHPAAGQCHQLQLPRQGQTLPAPR

Amino Acids from 3' Exons

AATRCSKASRRGTRCQHPSRG,PELPGVQRHHEEGVQGANTHPEE,LSYPVFKGIMKKGYKVPTPIQRK