McDonnell Genome Institute

Washington University

CircRNA

chr12|113119127|113119443|-|RASAL1|ENST00000546727.5

Cancer

Type of Peptide

EOGC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9001

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

24

Peptide

LVVGQESPSALPLTDHFLRPQTIK

Amino Acids from 5' Exons

GPGSQRHLWHIPICTCVLGQPELGDLSEWWGMKPGRSGAFGGGAGVPISSPTHRPLPSPSDHQEDSLPALGSAGAAGDARCPVPTAGGALGLGHGGQELLGH,DLAPRDISGTSDPFARVFWGSQSLETSVSGGESQEGVGHLVVGQESPSALPLTDHFLRPQTIKKTRFPHWDEVLELREMPGAPSPLRVELWDWDMVGKNDFLGM,TWLPETSLAHLTHLHVCFGAARAWRPQVVGNEARKEWGIWWWGRSPHQLSHSQTTSFALRPSRRLASRTGMKCWSCGRCQVPRPHCGWSSGTGTWWARMTSWA

Amino Acids from 3' Exons

GPGSQRHLWHIPICTCVLGQPELGDLSEWWGMKPGRSGAFGGGAGVPISSPTHRPLPSPSDHQEDSLPALGSAGAAGDARCPVPTAGGALGLGHGGQELLGH,DLAPRDISGTSDPFARVFWGSQSLETSVSGGESQEGVGHLVVGQESPSALPLTDHFLRPQTIKKTRFPHWDEVLELREMPGAPSPLRVELWDWDMVGKNDFLGM,TWLPETSLAHLTHLHVCFGAARAWRPQVVGNEARKEWGIWWWGRSPHQLSHSQTTSFALRPSRRLASRTGMKCWSCGRCQVPRPHCGWSSGTGTWWARMTSWA