McDonnell Genome Institute

Washington University

CircRNA

chr12|113103945|113104298|-|RASAL1|ENST00000261729.9

Cancer

Type of Peptide

BRCA-Basal-like

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9674

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

TSWPPATPVPSAAR

Amino Acids from 5' Exons

NVNELNQWLSALRKASAPNPNKLAACHPGAFRSARWTCCLQAERS,MMSSTSGSRPCARPAPPTRTSWPPATPVPSAARAGPAASRLSAQ,CEAQPVALGLAQGQRPQPEQAGRLPPRCLPQRALDLLPPGAL

Amino Acids from 3' Exons

MCHSIPVSHIRAVERVDEGAFQLPHVMQVVTQDGTGALHTTYLQCK,CVTPSPCLTSAPWSATRAPSNCPTCRWRRTARGRCTPPTSSA,VSLHPRVSHPRRGARRRGRLPTAPRDAGGDAGRHGGAAHHLPPVQ