McDonnell Genome Institute

Washington University

CircRNA

chr12|113002931|113005222|+|OAS2|ENST00000342315.8

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9992

5

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

13

17

Peptide

VLNESVSFDVLPAFNALACTTLHDPRPPSG

Amino Acids from 5' Exons

PAPLFTTPGHLLDKFIKEFLQPNKCFLEQIDSAVNIIRTFLKENCFRQSTAKIQIVR,LHHSSRPQATFWISSSRSFSSPTNASSRLTVLLTSSVHSLKKTASDNQQPRSRLS,CTTLHDPRPPSGVHQGVSPAQQMLPRADQCCHHPYIPRKLLPTINSQDPDCP

Amino Acids from 3' Exons

GGSTAKGTALKTGSDADLVVFHNSLKSYTSQKNERHKIVKEIHEQLKAFWREKEEELEVSFEPPKWKAPRVLSFSLKSKVLNESVSFDVLPAFNAL,EDQPPKAQLRLALMPISSCSITHLKATPPKKTSGTKSSRKSMNSKPFGGRRRRSLKSALSLPSGRLPGCASLNPKSSTKVSALMCFLPLMHW,RINRQRHSSEDWLCRSRRVPLTKLHLPKKRAAQNRQGNPTAESLLEGEGGGASQLASQVEGSQGAELLSEIQSPQRKCQLCASCLCT