McDonnell Genome Institute

Washington University

CircRNA

chr12|112319224|112319742|-|HECTD4|ENST00000377560.9

Cancer

Type of Peptide

LUAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

1

13

Peptide

ENAAAALVALACAR

Amino Acids from 5' Exons

ILTFETKNPSELAERLRSVCGNQSNAYARLLEYRLNALRGLWNAQRQLALEEQHERESSGDEETLALLKRQGLLQQPEQAPFTSRMGLLLVFPLIQSQSRTDPSLCNITAEVLLNCLRDCQPLSLTKEPADCLNGIETLLCSWLEETSDTGRHIPHKQKENAAAALVALACA,FPLRPRTRRNQNVCALFVGIRAMPMPGCWNTAMPCEDCGMPSASWPKNSMKGKVQVMRKLWPCSNARACCSNLSKRPSHRGWGSCWSSPLFSPRVEQTPLSVTLLRCYTAFVTASLAPRSLLTVSMELKLCCALGRRLLTQADTSHISKKKMLLLPWWLWLVP,FNLDQEPVGISRTFALCLWESEQCLCPAAGIPPECLARTVECPAPAGLRRTAKGKFRGNFGPAQTPGLVAATASALHIEDGAPAGLPPYSVPENRPLSLHNCGAIELPSLPAFELDQGACLSQWNNFAVLLARGDFHRPTHPTAKRKCCCCPGGFGLCQ

Amino Acids from 3' Exons

ILTFETKNPSELAERLRSVCGNQSNAYARLLEYRLNALRGLWNAQRQLALEEQHERESSGDEETLALLKRQGLLQQPEQAPFTSRMGLLLVFPLIQSQSRTDPSLCNITAEVLLNCLRDCQPLSLTKEPADCLNGIETLLCSWLEETSDTGRHIPHKQKENAAAALVALACA,FPLRPRTRRNQNVCALFVGIRAMPMPGCWNTAMPCEDCGMPSASWPKNSMKGKVQVMRKLWPCSNARACCSNLSKRPSHRGWGSCWSSPLFSPRVEQTPLSVTLLRCYTAFVTASLAPRSLLTVSMELKLCCALGRRLLTQADTSHISKKKMLLLPWWLWLVP,FNLDQEPVGISRTFALCLWESEQCLCPAAGIPPECLARTVECPAPAGLRRTAKGKFRGNFGPAQTPGLVAATASALHIEDGAPAGLPPYSVPENRPLSLHNCGAIELPSLPAFELDQGACLSQWNNFAVLLARGDFHRPTHPTAKRKCCCCPGGFGLCQ