McDonnell Genome Institute

Washington University

CircRNA

chr12|112239880|112319742|-|HECTD4|ENST00000377560.9

Cancer

Type of Peptide

PRAD

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

1

3

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

0

18

Peptide

TDPSLCNITAEVLLNCLR

Amino Acids from 5' Exons

NRTHMWWDGRAGPGSLWRDHDLCCVSVCSLPYRLRKHWTLMYHTLHQ,IEELTCGGMVEQVQEAFGETMTSVVSLCARYPIACANSIGLLCTIPYT,LKNSHVVGWSSRSRKPLARPPLLCLCVLVTLSLAQIALDSYVPYLTP

Amino Acids from 3' Exons

ILTFETKNPSELAERLRSVCGNQSNAYARLLEYRLNALRGLWNAQRQLALEEQHERESSGDEETLALLKRQGLLQQPEQAPFTSRMGLLLVFPLIQSQSRTDPSLCNITAEVLLNCLRDCQPLSLTKEPADCLNGIETLLCSWLEETSDTGRHIPHKQKENAAAALVALACA,FPLRPRTRRNQNVCALFVGIRAMPMPGCWNTAMPCEDCGMPSASWPKNSMKGKVQVMRKLWPCSNARACCSNLSKRPSHRGWGSCWSSPLFSPRVEQTPLSVTLLRCYTAFVTASLAPRSLLTVSMELKLCCALGRRLLTQADTSHISKKKMLLLPWWLWLVP,FNLDQEPVGISRTFALCLWESEQCLCPAAGIPPECLARTVECPAPAGLRRTAKGKFRGNFGPAQTPGLVAATASALHIEDGAPAGLPPYSVPENRPLSLHNCGAIELPSLPAFELDQGACLSQWNNFAVLLARGDFHRPTHPTAKRKCCCCPGGFGLCQ