McDonnell Genome Institute

Washington University

CircRNA

chr12|112178930|112185493|-|HECTD4|ENST00000377560.9

Cancer

Type of Peptide

LUAD

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9947

2

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

AVLNSVR

Amino Acids from 5' Exons

ILRKYGVPKPKFDKSKYSKAGKEQHPVKVVSTKRPITKPPAKDKAVLNSV,SGSMACQSPSLTRASTARPGRSSTPRWAPSGLSPSRPPRTRLCSTAS,PEEVWRAKAQVQEQVQQGREGAAPREGGEHQAAYHQAARQGQGCAQQRQ

Amino Acids from 3' Exons

ETSCGPRTWQPARSLFSISWQSSCARCTPWSRGGTPLACPPQSPSSTPAWPCWPCSRSSTSCTTRRRRTGSQAAPAGAPGGRRPVTRAGSLRIFMHSWKGAWLWPKPCLLTVSQPVGPQRPPQISVTRPPPPRPPQDRPHRVPASSPRGKKSRSGKRPPRRASASLPAPWTRTPPCSASEAASPRTCCGSTAHSPCSSSSATSPGRTHRGWARVTPSPMPARPWWAPPPTAACWSPGSPPTWTRASEAPSARPATPTAGSSKTRSTSRCRKKTPRSQKTRPRAGTGKLSPRRHWPSPAQTAWRSARPAAPPPASAPPPPPARPPSAARRASPKPSATSLWIRCLPASSCPSLRACWSPTRCPARKAWTFPCAAPAAWAAWAAWGSPWTMQRRPRCRTWAPCTQSLPWTTSPSPPAPSKASQSW,KLLVDHGHGSLREGACFPSPGRAPAHGAHPGAEAAPRWPVLLNRPPAEPLPGHADGLAVGAPQAVRRGDAELGLRRRLRGLRGGGGRPGQVLYVFSCTHGRVPGCGRSDPAYHECHSQWGDLSDRPKSQLVLLLLVLPRTDPTESQPPLQEEKSQDEAGKGLLVGQAPVFPHRGLGPHRAQHRRQQARGHAVVPPRTHPAHHPPPPHQEGPTGAGRDERHRRCLPGPGGPHRPQPLAGDLRDPHPPGRGRSQRRHPQGLQRPRRGLQRRDLHPAAGRRHQEAKRQGRGRGRESAREDTGLPRHRQHGGQHVQQPDPRHEHQRLRLHQPGLHLQLAGHLPNRQRPLCGSAACRPRAAHPSGPVGAPRGVQPGKPGHFPVQHRQPGQPGQPGGAPGQCRDGLGVGHGLHVHSHFPGQPAPRRPPHQRLRSRG,NFLWTTDMAACVKELVFHLLAELLRTVHTLEQRRHPAGLSSSIALQLNPCLAMLMALQSELHKLYDEETQNWVSGGACGGSGGAAAGDQGRFSTYFHALMEGCLAVAEVTLPTNMSVTASGVTSATAPNLSDSSSSSSSSPGQTPQSPSLLSKRKKVKMKREKASSSGKRQSSRTVDSDPTVLSIGGSKPEDMLWFHRALTLLIILRHLTRKDPQGLGVTSDAIADACQALVGPTAHSRLLVISGIPTHLDEGVVRGAIRKACNAHGGVFKDEIYIPLQEEDTKKPKDKAEGGDGKVEPEKTLAFPGTDSMEVSTSSSLTPAMSISASASTSQASICSSQGISQTVSDLSVDPLPAGLELPIPPGLLEPHAVSSQESLDISLCSTGSLGSLGSLGEPLDNAETASVSDMGSMYTVTSLDNQPLAARPIKGFAVVE