McDonnell Genome Institute

Washington University

CircRNA

chr12|112172670|112175859|-|HECTD4|ENST00000377560.9

Cancer

Type of Peptide

HCC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9838

26

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

6

4

Peptide

VACLLIPEEK

Amino Acids from 5' Exons

VRMHRCPTCTEGLKKVDPGDGRGTCAVHQPAMPPPRHHTRTAPSPGVPGPRGCCPQSGLSP,CACIDVRHAQKASRKWTLEMDVALVQYINQLCRHLAITPARLHPHEVYLDPADAADPRVACLL,AHASMSDMHRRPQESGPWRWTWHLCSTSTSYAATSPSHPHGSIPMRCTWTPRMLLTPEWPVS

Amino Acids from 3' Exons

SLRKNTRWKDFTNLLLTEPGKISVASGGRSCPVVTIFTLR,PGKIPDAGRISQICYPSQARYPRLEGDLVLWLRSSLE,PEEKYLTLEGFHKFVIDRARQDIRSVWRAILSCGYDLHFE