McDonnell Genome Institute

Washington University

CircRNA

chr12|112060269|112061388|-|NAA25|ENST00000261745.8

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9871

10

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

5

2

Peptide

LLMYGGK

Amino Acids from 5' Exons

GKPVKQNCNFLTITVSLLSMRLLMYGGKQ,ENLFENRIAIFLLLSPCCPCAYCMEGN,KTCLKTELQFSDYYCLLAVHALIDVWRET

Amino Acids from 3' Exons

FINQLLGVVPLSTPTEDKLALPADIRALQQHLCVVQLTRLLGLYHTMDKNQKLSVVRELMLRYQHGLEF,LLISYLELFLCRHQQRISWHCLLTSELCSNICVWCSRGYLACTTPWIKIRNVWSENCGTSMDWNL,YSVTWSCSFVDTNRGAGTACHQSSAATFVCGAADEVTWLVPHHGKSEIECGQRIDVKVPAWTGI