McDonnell Genome Institute

Washington University

CircRNA

chr12|111781917|111790562|+|RP11-162P23.2|ENST00000546840.2

Cancer

Type of Peptide

EOGC

junction_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9957

14

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

12

2

Peptide

EIFINNEWHDAVSR

Amino Acids from 5' Exons

IFINNEWHDAVSRKTFPTVNPSTGEVICQVAEGDK,FSTMNGTMPSAGKHSPPSIRPLERSSVRLKGT,FHKQMARCRQQENIPHRQSVHWRGHLSGSRGQ

Amino Acids from 3' Exons

WNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKE,GISRSCKHGSWAQPWQLETWLRLSRHPSPPSMWPTSR,EFPAPDASMEAGPSLGNWKRGCDEGSADTPHRPLCGQPDQG