McDonnell Genome Institute

Washington University

CircRNA

chr12|111775604|111783298|+|ALDH2|ENST00000548536.1

Cancer

Type of Peptide

HCC

noncanonical_peptide

Highest Probability Peptide Matching Spectra

No. of Spectra

0.9241

77

No. of Amino Acids from 5' Exons

No. of Amino Acids from 3' Exons

14

2

Peptide

LKMSTPDITVLLETIK

Amino Acids from 5' Exons

SRLKMSTPDITVLLETIKRKWELGHPPTTPRPRAFTCV,LDKCQLQTSLCFWKLRGSGSDIPPPRPAQERLRVL,IENVNSRHHCASGNYKEEVGARTSPHHAPPKSVYVCY

Amino Acids from 3' Exons

EDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA,KMWTRQRPPGPPSSWAHLGAAWTHHTGAGCTAWPISSGTGPTW,RCGQGSEGRPGRLPAGLTLAPHGRITQGPAAEPPGRSDRAGPDLPG